ravenhawksmagickalmysticalplaces.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | Index of |
| Description | Index of / Name Last modified Size Description 400.shtml 2011-09-01 10:52 130 401.shtml 2011-09-01 10:52 162 403.shtml 2011-09-01 10:52 201 404.shtml 2011 |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 50.87.64.66 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
ravenhawksmagickalmysticalplaces.com Valuation
|
US$530
Last updated: 2022-07-13 13:37:28
ravenhawksmagickalmysticalplaces.com has Semrush global rank of 0. ravenhawksmagickalmysticalplaces.com has an estimated worth of US$ 530, based on its estimated Ads revenue. ravenhawksmagickalmysticalplaces.com receives approximately 61 unique visitors each day. Its web server is located in United States, with IP address 50.87.64.66. According to SiteAdvisor, ravenhawksmagickalmysticalplaces.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$530 |
| Daily Ads Revenue | US$0 |
| Monthly Ads Revenue | US$14 |
| Yearly Ads Revenue | US$176 |
| Daily Unique Visitors | 4 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| ravenhawksmagickalmysticalplaces.com. 7199 IN A | A | IP: 50.87.64.66 | |
| ravenhawksmagickalmysticalplaces.com. 86400 IN NS ns1.justhost.com. | NS | NS Record: ravenhawksmagickalmysticalplaces.com. 86400 IN NS ns1.justhost.com. | |
| ravenhawksmagickalmysticalplaces.com. 86400 IN NS ns2.justhost.com. | NS | NS Record: ravenhawksmagickalmysticalplaces.com. 86400 IN NS ns2.justhost.com. | |
| ravenhawksmagickalmysticalplaces.com. 14400 IN MX 0 mail.ravenhawksmagickalmysticalplaces.com. | MX | MX Record: ravenhawksmagickalmysticalplaces.com. 14400 IN MX 0 mail.ravenhawksmagickalmysticalplaces.com. | |
| ravenhawksmagickalmysticalplaces.com. 14400 IN TXT v=spf1 +a +mx +ip4:173.254.28.234 +ip4:50.87.64.66 +include:justhost.com ~all | TXT | TXT Record: ravenhawksmagickalmysticalplaces.com. 14400 IN TXT v=spf1 +a +mx +ip4:173.254.28.234 +ip4:50.87.64.66 +include:justhost.com ~all |
HtmlToTextCheckTime:2022-07-13 13:37:28
| Index of / Name Last modified Size Description 400.shtml 2011-09-01 10:52 130 401.shtml 2011-09-01 10:52 162 403.shtml 2011-09-01 10:52 201 404.shtml 2011-09-01 10:52 83 500.php 2012-07-10 08:11 461 500.shtml 2011-09-01 10:52 71 BingSiteAuth.xml 2018-11-01 19:56 85 cgi-bin/ 2019-06-28 11:23 - crystal-dawn/ 2018-05-09 10:08 - discussions/ 2017-11-19 15:33 - discussions_old/ 2017-01-07 00:56 - favicon.ico 2018-01-30 20:31 3.0K googled5966e74590180..> 2018-11-01 21:25 53 ladydyanna.net./ 2020-03-31 14:48 - ladydyanna/ 2020-03-31 17:46 - ladydyanna1 2017-10-12 22:17 11K sitemap.xml 2019-06-28 16:36 941 ssv3_directory.php 2019-04-30 13:34 772 wyndesong/ 2021-03-03 23:08 |
HTTP Headers
HTTP/1.1 302 Found Date: Mon, 01 Nov 2021 04:28:43 GMT Server: Apache Location: https://www.ravenhawksmagickalmysticalplaces.com/ Content-Type: text/html; charset=iso-8859-1 HTTP/2 200 content-type: text/html;charset=ISO-8859-1 date: Mon, 01 Nov 2021 04:28:43 GMT server: Apache |
ravenhawksmagickalmysticalplaces.com Whois Information
Domain Name: RAVENHAWKSMAGICKALMYSTICALPLACES.COM Registry Domain ID: 1116999574_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.enom.com Registrar URL: http://www.enomdomains.com Updated Date: 2021-07-13T18:40:51Z Creation Date: 2007-07-29T00:56:37Z Registry Expiry Date: 2022-07-29T00:56:37Z Registrar: eNom, LLC Registrar IANA ID: 48 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS1.JUSTHOST.COM Name Server: NS2.JUSTHOST.COM DNSSEC: unsigned >>> Last update of whois database: 2021-09-19T13:52:20Z <<< |